PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g009190.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 677aa    MW: 76247.7 Da    PI: 6.3257
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g009190.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3415.94.4e-127404031350
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       eel++rmwkd+++lkrlker+k    +++ a++++k++++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++ra
  Sopen01g009190.2  40 EELERRMWKDRVKLKRLKERQKIA--AQQ-AAEKQKNKQTTDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRA 129
                       8*******************9964..455.599************************************************************ PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fd+ngpaai+ky+a++   +++ s+  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWP+G+++ww ++gl
  Sopen01g009190.2 130 WWKEKVKFDKNGPAAIAKYEAECHSKGEGISN--QNGNPQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVSPPWWPSGNDEWWVKMGL 220
                       *******************9988766655555..67999999*************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.....XXXX..X CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.....slrk..q 270
                       +k q+ ppykkphdlkk++kv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++l+vl++ee+ ++    +  ss      +r   +
  Sopen01g009190.2 221 PKGQK-PPYKKPHDLKKMFKVGVLTAVIKHMSPDIAKIRRLVRQSKCLQDKMTAKESSIWLAVLSREESTIRLQTNDngSSsiseaPIRGhgD 312
                       *****.9**************************************************************997666666633566664444345 PP

                       XXXXXXXXXXXXXXX.......XXXXXX.XXXXXXXXXX.................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XX CS
              EIN3 271 spkvtlsceqkedve.......gkkeskikhvqavktta.................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgset 339
                       ++k  +++++++dv+                   +++++                 +++   +r+++++ ++  +    +++  s+q ++   
  Sopen01g009190.2 313 KKKSSVDSDSDYDVDdvnvsvsS----------RDERRNepldarpltdvpqshqsKEQGDGQRRRRKRARSNFQ---QTQLSPSEQQPDDVA 392
                       66666666777777744333321..........222222355667777666665443333333333333333332...246778888888888 PP

                       XXXXXXXXXXX CS
              EIN3 340 elifadknsis 350
                       ++ ++d+n+ +
  Sopen01g009190.2 393 RNSLPDMNNSN 403
                       88888887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.4E-12440287No hitNo description
Gene3DG3DSA:1.10.3180.107.2E-69162292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.63E-60168290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MEYCMIDADG LGNSSDIEVD DIRCDNIAEK DVSDEEIDPE ELERRMWKDR VKLKRLKERQ  60
KIAAQQAAEK QKNKQTTDQA RRKKMSRAQD GILKYMLKLM EVCKARGFVY GIIPEKGKPV  120
SGSSDNIRAW WKEKVKFDKN GPAAIAKYEA ECHSKGEGIS NQNGNPQSVL QDLQDATLGS  180
LLSSLMQHCD PPQRKYPLEK GVSPPWWPSG NDEWWVKMGL PKGQKPPYKK PHDLKKMFKV  240
GVLTAVIKHM SPDIAKIRRL VRQSKCLQDK MTAKESSIWL AVLSREESTI RLQTNDNGSS  300
SISEAPIRGH GDKKKSSVDS DSDYDVDDVN VSVSSRDERR NEPLDARPLT DVPQSHQSKE  360
QGDGQRRRRK RARSNFQQTQ LSPSEQQPDD VARNSLPDMN NSNAQFSGYI ANESQPENNM  420
MVPRKSVERN SEGQSDLPLE ESNLSMVPSA NAVSTEETFV GNGPSIYPML ENSEVVPYES  480
RFHPGTQDSV VQRQLHDTQL QSRPQFSGMN NEPPNSIFHY GPPNNGLHNG SQSSVLHHEL  540
QYSGFIHGSQ YSNLHKPPVY QYFTPSAEFG SAHEEQQSHL AFGQPQIKPQ DSGVRSAVLH  600
GDRNGMSRED HHYGKDAFQN DHDRPAEMHF ASPITSGSPD YARLSSPFNF ELDVPSPLDT  660
GDLELFLDED VMTFFAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-711672919133ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071039.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
SwissprotO231161e-176EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK4AU850.0K4AU85_SOLLC; Uncharacterized protein
STRINGSolyc01g014480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-158ETHYLENE-INSENSITIVE3-like 3